Lineage for d3cwcb1 (3cwc B:1-379)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151990Fold c.141: Glycerate kinase I [110737] (1 superfamily)
    consists of two different alpha/beta domains; (1) of the Flavodoxin-like fold (52171); (2) similar to the Restriction endonuclease-like fold (52979), inserted into domain 1
  4. 2151991Superfamily c.141.1: Glycerate kinase I [110738] (2 families) (S)
  5. 2151997Family c.141.1.0: automated matches [191545] (1 protein)
    not a true family
  6. 2151998Protein automated matches [190937] (1 species)
    not a true protein
  7. 2151999Species Salmonella typhimurium [TaxId:90371] [188485] (1 PDB entry)
  8. 2152001Domain d3cwcb1: 3cwc B:1-379 [173514]
    Other proteins in same PDB: d3cwca2, d3cwcb2
    automated match to d1to6a_
    complexed with cl, edo

Details for d3cwcb1

PDB Entry: 3cwc (more details), 2.23 Å

PDB Description: Crystal structure of putative glycerate kinase 2 from Salmonella typhimurium LT2
PDB Compounds: (B:) Putative glycerate kinase 2

SCOPe Domain Sequences for d3cwcb1:

Sequence, based on SEQRES records: (download)

>d3cwcb1 c.141.1.0 (B:1-379) automated matches {Salmonella typhimurium [TaxId: 90371]}
mkiviapdsykeslsalevataieqgfreiwpdadylklpladggegtveamveatagri
vhvevtgplghrvnafyglsgdarsafiemaaasgleqvppaqrdplkttswgtgelirh
aldagvehiiigiggsatndggagmvqalgarlrdaqgndiaqggigletlasidisgld
krlsachievacdvtnpltgkegasavfgpqkgatpemierldtaltryahliardlhvd
vldlagggaaggmgaalyafcgaqlrrgieivtdalhleacladadlvitgegridsqti
hgkvpigvaniakrynkpvigiagsltadvsvvhehgldavfsviytictledalknase
nvrmtarnvaatlkagqql

Sequence, based on observed residues (ATOM records): (download)

>d3cwcb1 c.141.1.0 (B:1-379) automated matches {Salmonella typhimurium [TaxId: 90371]}
mkiviapdsykeslsalevataieqgfreiwpdadylklpladggegtveamveatagri
vhvevtgplghrvnafyglsgdarsafiemaaasgleqvppaqrdplkttswgtgelirh
aldagvehiiigiggsatndggagmvqalgarlrdaqgndiaqggigletlasidisgld
krlsachievacdvtnpltgkegasavfgpqkgatpemierldtaltryahliardlhvd
vldlagggaaggmgaalyafcgaqlrrgieivtdalhleacladadlvitgegridsqti
hgkvpigvaniakrynkpvigiagsltahgldavfsviytictledalknasenvrmtar
nvaatlkagqql

SCOPe Domain Coordinates for d3cwcb1:

Click to download the PDB-style file with coordinates for d3cwcb1.
(The format of our PDB-style files is described here.)

Timeline for d3cwcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwcb2