SCOPe 2.06: Domain d3cw0d_: 3cw0 D:

Lineage for d3cw0d_ (3cw0 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.184: TorD-like [89154] (1 superfamily)
   multihelical; bundle

4. Superfamily a.184.1: TorD-like [89155] (1 family)

5. Family a.184.1.1: TorD-like [89156] (5 proteins)
   Pfam PF06192

6. Protein automated matches [191026] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries)

8. Domain d3cw0d_: 3cw0 D: [173511]
   automated match to d1s9ua_

Details for d3cw0d_

PDB Entry: 3cw0, 2.4 Å

PDB Description: e.coli dmsd

PDB Compounds: (D:) Twin-arginine leader-binding protein dmsD

SCOPe Domain Sequences for d3cw0d_:

Sequence; same for both SEQRES and ATOM records:

>d3cw0d_ a.184.1.1 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
thfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtafq
tqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemkq
nepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralgel
arltlaqwqsqllipvavkplfr

Timeline for d3cw0d_:

• d3cw0d_ first appeared in SCOPe 2.01
  
• d3cw0d_ appears in SCOPe 2.05
  
• d3cw0d_ appears in SCOPe 2.07
  
• d3cw0d_ appears in the current release, SCOPe 2.08