Lineage for d3cw0c_ (3cw0 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736108Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2736109Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2736110Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2736126Protein automated matches [191026] (2 species)
    not a true protein
  7. 2736132Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries)
  8. 2736137Domain d3cw0c_: 3cw0 C: [173510]
    automated match to d1s9ua_

Details for d3cw0c_

PDB Entry: 3cw0 (more details), 2.4 Å

PDB Description: e.coli dmsd
PDB Compounds: (C:) Twin-arginine leader-binding protein dmsD

SCOPe Domain Sequences for d3cw0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw0c_ a.184.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
thfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtafq
tqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemkq
nepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralgel
arltlaqwqsqllipvavkplfr

SCOPe Domain Coordinates for d3cw0c_:

Click to download the PDB-style file with coordinates for d3cw0c_.
(The format of our PDB-style files is described here.)

Timeline for d3cw0c_: