![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.184: TorD-like [89154] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.184.1: TorD-like [89155] (1 family) ![]() |
![]() | Family a.184.1.1: TorD-like [89156] (5 proteins) Pfam PF06192 |
![]() | Protein automated matches [191026] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries) |
![]() | Domain d3cw0a_: 3cw0 A: [173508] automated match to d1s9ua_ |
PDB Entry: 3cw0 (more details), 2.4 Å
SCOPe Domain Sequences for d3cw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw0a_ a.184.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} thfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtafq tqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemkq nepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralgel arltlaqwqsqllipvavkplfr
Timeline for d3cw0a_: