Lineage for d3cvmb_ (3cvm B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568293Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 2568294Species Human (Homo sapiens) [TaxId:9606] [56588] (16 PDB entries)
  8. 2568298Domain d3cvmb_: 3cvm B: [173505]
    automated match to d1a7ca_

Details for d3cvmb_

PDB Entry: 3cvm (more details), 2.02 Å

PDB Description: High resolution structure of a stable Plasminogen activator inhibitor type-1 in its protease cleaved form
PDB Compounds: (B:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d3cvmb_:

Sequence, based on SEQRES records: (download)

>d3cvmb_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
avhhppsyvarlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiq
aamgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrs
tvkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpf
pdssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaa
pyekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmf
rqfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpfl
fvvrhnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d3cvmb_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
avhhppsyvarlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiq
aamgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrs
tvkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpf
pdssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaa
pyekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmf
rqfqadftslsdqeplhvalalqkvkievnesgtvassstavivsareeiiidrpflfvv
rhnptgtvlfmgqvmep

SCOPe Domain Coordinates for d3cvmb_:

Click to download the PDB-style file with coordinates for d3cvmb_.
(The format of our PDB-style files is described here.)

Timeline for d3cvmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cvma_