Lineage for d3cvla_ (3cvl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007418Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 2007422Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [63617] (6 PDB entries)
  8. 2007427Domain d3cvla_: 3cvl A: [173503]
    automated match to d1fcha_

Details for d3cvla_

PDB Entry: 3cvl (more details), 2.15 Å

PDB Description: Structure of Peroxisomal Targeting Signal 1 (PTS1) binding domain of Trypanosoma brucei Peroxin 5 (TbPEX5)complexed to T. brucei Phosphofructokinase (PFK) PTS1 peptide
PDB Compounds: (A:) Peroxisome targeting signal 1 receptor PEX5

SCOPe Domain Sequences for d3cvla_:

Sequence, based on SEQRES records: (download)

>d3cvla_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
tdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqaapereeawrslgltqae
nekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqpqyeqlgs
vnlqadvdiddlnvqsedfffaapneyrecrtllhaalemnpndaqlhaslgvlynlsnn
ydsaaanlrravelrpddaqlwnklgatlangnrpqealdaynraldinpgyvrvmynma
vsysnmsqydlaakqlvraiymqvggttptgeasreatrsmwdffrmllnvmnrpdlvel
tyaqnvepfakefglqs

Sequence, based on observed residues (ATOM records): (download)

>d3cvla_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
tdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqaapereeawrslgltqae
nekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqpqyeqlff
faapneyrecrtllhaalemnpndaqlhaslgvlynlsnnydsaaanlrravelrpddaq
lwnklgatlangnrpqealdaynraldinpgyvrvmynmavsysnmsqydlaakqlvrai
ymqvggttpasreatrsmwdffrmllnvmnrpdlveltyaqnvepfakefglqs

SCOPe Domain Coordinates for d3cvla_:

Click to download the PDB-style file with coordinates for d3cvla_.
(The format of our PDB-style files is described here.)

Timeline for d3cvla_: