Lineage for d3cvdc_ (3cvd C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940491Protein Plastocyanin [49507] (16 species)
  7. 940516Species Phormidium laminosum [TaxId:32059] [49518] (8 PDB entries)
  8. 940521Domain d3cvdc_: 3cvd C: [173500]
    automated match to d1bawa_
    complexed with cu1, zn

Details for d3cvdc_

PDB Entry: 3cvd (more details), 1.5 Å

PDB Description: regulation of protein function: crystal packing interfaces and conformational dimerization
PDB Compounds: (C:) plastocyanin

SCOPe Domain Sequences for d3cvdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvdc_ b.6.1.1 (C:) Plastocyanin {Phormidium laminosum [TaxId: 32059]}
etftvkmgadsglfqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitve

SCOPe Domain Coordinates for d3cvdc_:

Click to download the PDB-style file with coordinates for d3cvdc_.
(The format of our PDB-style files is described here.)

Timeline for d3cvdc_: