Lineage for d3cvca_ (3cvc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770828Protein Plastocyanin [49507] (17 species)
  7. 2770856Species Phormidium laminosum [TaxId:32059] [49518] (8 PDB entries)
  8. 2770865Domain d3cvca_: 3cvc A: [173497]
    automated match to d1bawa_
    complexed with cu, mg

Details for d3cvca_

PDB Entry: 3cvc (more details), 1.72 Å

PDB Description: regulation of protein function: crystal packing interfaces and conformational dimerization
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d3cvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvca_ b.6.1.1 (A:) Plastocyanin {Phormidium laminosum [TaxId: 32059]}
etftvkmgadsglfqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

SCOPe Domain Coordinates for d3cvca_:

Click to download the PDB-style file with coordinates for d3cvca_.
(The format of our PDB-style files is described here.)

Timeline for d3cvca_: