Lineage for d3cv9a_ (3cv9 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921121Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 921122Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 921536Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 921537Protein automated matches [190847] (10 species)
    not a true protein
  7. 921599Species Streptomyces griseolus [TaxId:1909] [188416] (5 PDB entries)
  8. 921602Domain d3cv9a_: 3cv9 A: [173493]
    automated match to d1cl6a_
    complexed with hem, vdx; mutant

Details for d3cv9a_

PDB Entry: 3cv9 (more details), 1.7 Å

PDB Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (R73A/R84A mutant) in complex with 1alpha,25-dihydroxyvitamin D3
PDB Compounds: (A:) Cytochrome P450-SU1

SCOPe Domain Sequences for d3cv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cv9a_ a.104.1.0 (A:) automated matches {Streptomyces griseolus [TaxId: 1909]}
pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
rlssnatddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve
evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq
saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe
ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg
qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev
ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhh

SCOPe Domain Coordinates for d3cv9a_:

Click to download the PDB-style file with coordinates for d3cv9a_.
(The format of our PDB-style files is described here.)

Timeline for d3cv9a_: