Lineage for d3cv7a_ (3cv7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2080974Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2081106Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)
  8. 2081115Domain d3cv7a_: 3cv7 A: [173491]
    automated match to d1ae4a_
    protein/RNA complex; complexed with c2u, nap, so4

Details for d3cv7a_

PDB Entry: 3cv7 (more details), 2.41 Å

PDB Description: Crystal structure of porcine aldehyde reductase ternary complex
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d3cv7a_:

Sequence, based on SEQRES records: (download)

>d3cv7a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
maascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigeal
qetvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafer
gdnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrp
avlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaek
ynrspaqillrwqvqrkvicipksvtpsrilqniqvfdftfspeemkqldalnknlrfiv
pmltvdgkrvprdaghplypfndpy

Sequence, based on observed residues (ATOM records): (download)

>d3cv7a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
maascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigeal
qetvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafer
gdnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrp
avlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaek
ynrspaqillrwqvqrkvicipksvtpsrilqniqvfdftfspeemkqldalnknlrfiv
pmltvdvprdaghplypfndpy

SCOPe Domain Coordinates for d3cv7a_:

Click to download the PDB-style file with coordinates for d3cv7a_.
(The format of our PDB-style files is described here.)

Timeline for d3cv7a_: