![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein automated matches [190169] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries) |
![]() | Domain d3cv6b_: 3cv6 B: [173490] automated match to d1j96a_ complexed with bme, hxs, nap; mutant |
PDB Entry: 3cv6 (more details), 2.1 Å
SCOPe Domain Sequences for d3cv6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cv6b_ c.1.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mnskchcvilndgnfipvlgfgtalplecpkskakeltkiaidagfhhfdsasvyntedh vgeairskiadgtvrredifytskvwctslhpelvraslerslqklqfdyvdlylihypm alkpgeenfpvdehgklifdrvdlcatweamekckdagltksigvsnfnyrqlemilnkp glkykpvcnqvechpylnqmklldfckskdivlvaygvlgtqryppwvdqnspvlldepv lgsmakkynrtpalialryqlqrgivvlntslkeerikenmqvfefqlssedmkvldgln rnmryipaaifkghpnwpfldey
Timeline for d3cv6b_: