Lineage for d3cv0a1 (3cv0 A:332-653)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333862Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 2333866Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [63617] (6 PDB entries)
  8. 2333868Domain d3cv0a1: 3cv0 A:332-653 [173488]
    Other proteins in same PDB: d3cv0a2
    automated match to d1fcha_
    complexed with edo

Details for d3cv0a1

PDB Entry: 3cv0 (more details), 2 Å

PDB Description: structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei phosphoglucoisomerase (pgi) pts1 peptide
PDB Compounds: (A:) Peroxisome targeting signal 1 receptor PEX5

SCOPe Domain Sequences for d3cv0a1:

Sequence, based on SEQRES records: (download)

>d3cv0a1 a.118.8.1 (A:332-653) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
lqnntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqaapereeawrslgl
tqaenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqpqye
qlgsvnlqadvdiddlnvqsedfffaapneyrecrtllhaalemnpndaqlhaslgvlyn
lsnnydsaaanlrravelrpddaqlwnklgatlangnrpqealdaynraldinpgyvrvm
ynmavsysnmsqydlaakqlvraiymqvggttptgeasreatrsmwdffrmllnvmnrpd
lveltyaqnvepfakefglqsm

Sequence, based on observed residues (ATOM records): (download)

>d3cv0a1 a.118.8.1 (A:332-653) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
lqnntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqaapereeawrslgl
tqaenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqpqye
qlfffaapneyrecrtllhaalemnpndaqlhaslgvlynlsnnydsaaanlrravelrp
ddaqlwnklgatlangnrpqealdaynraldinpgyvrvmynmavsysnmsqydlaakql
vraiymqvggttsreatrsmwdffrmllnvmnrpdlveltyaqnvepfakefglqsm

SCOPe Domain Coordinates for d3cv0a1:

Click to download the PDB-style file with coordinates for d3cv0a1.
(The format of our PDB-style files is described here.)

Timeline for d3cv0a1: