Lineage for d3cusa_ (3cus A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453668Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1453669Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1453670Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 1453700Protein automated matches [190110] (5 species)
    not a true protein
  7. 1453714Species Desulfovibrio fructosovorans [TaxId:878] [188149] (5 PDB entries)
  8. 1453727Domain d3cusa_: 3cus A: [173478]
    Other proteins in same PDB: d3cusq_, d3cusr_, d3cuss_
    automated match to d1frfs_
    complexed with f3s, fco, gol, mg, ni, sf4; mutant

Details for d3cusa_

PDB Entry: 3cus (more details), 2.2 Å

PDB Description: Structure of a double ILE/PHE mutant of NI-FE hydrogenase refined at 2.2 angstrom resolution
PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d3cusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cusa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d3cusa_:

Click to download the PDB-style file with coordinates for d3cusa_.
(The format of our PDB-style files is described here.)

Timeline for d3cusa_: