Lineage for d3cu9a_ (3cu9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802003Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1802009Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1802010Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 1802062Protein automated matches [191033] (1 species)
    not a true protein
  7. 1802063Species Geobacillus stearothermophilus [TaxId:1422] [188852] (5 PDB entries)
  8. 1802064Domain d3cu9a_: 3cu9 A: [173466]
    automated match to d1wl7a1
    complexed with ca, gol

Details for d3cu9a_

PDB Entry: 3cu9 (more details), 1.06 Å

PDB Description: High resolution crystal structure of 1,5-alpha-L-arabinanase from Geobacillus Stearothermophilus
PDB Compounds: (A:) Intracellular arabinanase

SCOPe Domain Sequences for d3cu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu9a_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpylsv

SCOPe Domain Coordinates for d3cu9a_:

Click to download the PDB-style file with coordinates for d3cu9a_.
(The format of our PDB-style files is described here.)

Timeline for d3cu9a_: