Class b: All beta proteins [48724] (176 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
Protein automated matches [191033] (1 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [188852] (5 PDB entries) |
Domain d3cu9a_: 3cu9 A: [173466] automated match to d1wl7a1 complexed with ca, gol |
PDB Entry: 3cu9 (more details), 1.06 Å
SCOPe Domain Sequences for d3cu9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu9a_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir plywddegwpylsv
Timeline for d3cu9a_: