Lineage for d3cu8b_ (3cu8 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007236Protein zeta isoform [48449] (2 species)
  7. 2007246Species Human (Homo sapiens) [TaxId:9606] [48451] (8 PDB entries)
  8. 2007254Domain d3cu8b_: 3cu8 B: [173465]
    automated match to d1qjba_
    complexed with mg, ppi

Details for d3cu8b_

PDB Entry: 3cu8 (more details), 2.4 Å

PDB Description: impaired binding of 14-3-3 to raf1 is linked to noonan and leopard syndrome
PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3cu8b_:

Sequence, based on SEQRES records: (download)

>d3cu8b_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d3cu8b_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqkteekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkmk
gdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeil
nspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d3cu8b_:

Click to download the PDB-style file with coordinates for d3cu8b_.
(The format of our PDB-style files is described here.)

Timeline for d3cu8b_: