Lineage for d3cu4a_ (3cu4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691652Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)
  8. 2691653Domain d3cu4a_: 3cu4 A: [173463]
    automated match to d1gdva_
    complexed with hem

Details for d3cu4a_

PDB Entry: 3cu4 (more details), 1.3 Å

PDB Description: OmcF, Outer membrance cytochrome F from Geobacter sulfurreducens
PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3cu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu4a_ a.3.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
gggelfathcagchpqggntvhpektlararreangirtvrdvaayirnpgpgmpafgea
mippadalkigeyvvasfp

SCOPe Domain Coordinates for d3cu4a_:

Click to download the PDB-style file with coordinates for d3cu4a_.
(The format of our PDB-style files is described here.)

Timeline for d3cu4a_: