SCOP 1.57: Domain d1djha1: 1djh A:200-298

Lineage for d1djha1 (1djh A:200-298)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.39: EF Hand-like [47472] (3 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)

6. Protein Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) [47548] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47549] (10 PDB entries)

8. Domain d1djha1: 1djh A:200-298 [17346]
   Other proteins in same PDB: d1djha2, d1djha3, d1djhb2, d1djhb3

Details for d1djha1

PDB Entry: 1djh, 2.5 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with barium

SCOP Domain Sequences for d1djha1:

Sequence; same for both SEQRES and ATOM records:

>d1djha1 a.39.1.7 (A:200-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus)}
eietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslierye
psetakaqrqmtkdgflmyllsadgnafslahrrvyqdm

Timeline for d1djha1:

• d1djha1 first appeared (with stable ids) in SCOP 1.55
  
• d1djha1 appears in SCOP 1.59
  
• d1djha1 appears in the current release, SCOPe 2.08