SCOPe 2.03: Domain d3ctlc_: 3ctl C:

Lineage for d3ctlc_ (3ctl C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (20 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188791] (2 PDB entries)

8. Domain d3ctlc_: 3ctl C: [173454]
   automated match to d2flia1
   complexed with mg, s6p

Details for d3ctlc_

PDB Entry: 3ctl, 2.2 Å

PDB Description: Crystal structure of D-Allulose 6-Phosphate 3-Epimerase from Escherichia coli K12 complexed with D-glucitol 6-phosphate and magnesium

PDB Compounds: (C:) D-allulose-6-phosphate 3-epimerase

SCOPe Domain Sequences for d3ctlc_:

Sequence; same for both SEQRES and ATOM records:

>d3ctlc_ c.1.2.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
mkispslmcmdllkfkeqiefidshadyfhidimdghfvpnltlspffvsqvkklatkpl
dchlmvtrpqdyiaqlaragadfitlhpetingqafrlideirrhdmkvglilnpetpve
amkyyihkadkitvmtvdpgfagqpfipemldklaelkawreregleyeievdgscnqat
yeklmaagadvfivgtsglfnhaenideawrimtaqila

Timeline for d3ctlc_:

• d3ctlc_ first appeared in SCOPe 2.01
  
• d3ctlc_ appears in SCOPe 2.02
  
• d3ctlc_ appears in SCOPe 2.04
  
• d3ctlc_ appears in the current release, SCOPe 2.08