Lineage for d3ct7f_ (3ct7 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827521Species Escherichia coli [TaxId:562] [188791] (2 PDB entries)
  8. 2827533Domain d3ct7f_: 3ct7 F: [173451]
    automated match to d2flia1
    complexed with mg, so4

Details for d3ct7f_

PDB Entry: 3ct7 (more details), 2.5 Å

PDB Description: Crystal structure of D-allulose 6-phosphate 3-epimerase from Escherichia Coli K-12
PDB Compounds: (F:) D-allulose-6-phosphate 3-epimerase

SCOPe Domain Sequences for d3ct7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ct7f_ c.1.2.0 (F:) automated matches {Escherichia coli [TaxId: 562]}
mkispslmcmdllkfkeqiefidshadyfhidimdghfvpnltlspffvsqvkklatkpl
dchlmvtrpqdyiaqlaragadfitlhpetingqafrlideirrhdmkvglilnpetpve
amkyyihkadkitvmtvdpgfagqpfipemldklaelkawreregleyeievdgscnqat
yeklmaagadvfivgtsglfnhaenideawrimtaqila

SCOPe Domain Coordinates for d3ct7f_:

Click to download the PDB-style file with coordinates for d3ct7f_.
(The format of our PDB-style files is described here.)

Timeline for d3ct7f_: