Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (20 species) not a true protein |
Species Escherichia coli [TaxId:562] [188791] (2 PDB entries) |
Domain d3ct7e_: 3ct7 E: [173450] automated match to d2flia1 complexed with mg, so4 |
PDB Entry: 3ct7 (more details), 2.5 Å
SCOPe Domain Sequences for d3ct7e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ct7e_ c.1.2.0 (E:) automated matches {Escherichia coli [TaxId: 562]} mkispslmcmdllkfkeqiefidshadyfhidimdghfvpnltlspffvsqvkklatkpl dchlmvtrpqdyiaqlaragadfitlhpetingqafrlideirrhdmkvglilnpetpve amkyyihkadkitvmtvdpgfagqpfipemldklaelkawreregleyeievdgscnqat yeklmaagadvfivgtsglfnhaenideawrimtaqila
Timeline for d3ct7e_: