Lineage for d3ct4b_ (3ct4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150492Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2150493Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2150540Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2150541Protein automated matches [190655] (10 species)
    not a true protein
  7. 2150549Species Lactococcus lactis [TaxId:1358] [188636] (3 PDB entries)
  8. 2150555Domain d3ct4b_: 3ct4 B: [173444]
    automated match to d1oi2a_
    complexed with 2ha

Details for d3ct4b_

PDB Entry: 3ct4 (more details), 2.5 Å

PDB Description: structure of dha-kinase subunit dhak from l. lactis
PDB Compounds: (B:) PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK

SCOPe Domain Sequences for d3ct4b_:

Sequence, based on SEQRES records: (download)

>d3ct4b_ c.119.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 1358]}
ekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghepaha
gfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemaremae
meeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdladkvv
kniktiglalsaatvpevgkpgfvlddneieygvgihsepgyrrekmktsyelatelvgk
lkeefkfeagqkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymtsidm
aglsltmikleddqwlknlnedvktisw

Sequence, based on observed residues (ATOM records): (download)

>d3ct4b_ c.119.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 1358]}
ekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghepaha
gfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemaremae
meeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdladkvv
kniktiglalsaatvpdneieygvgihsepgyrrekmktsyelatelvgklkeefkfeag
qkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymtsidmaglsltmikl
eddqwlknlnedvktisw

SCOPe Domain Coordinates for d3ct4b_:

Click to download the PDB-style file with coordinates for d3ct4b_.
(The format of our PDB-style files is described here.)

Timeline for d3ct4b_: