SCOPe 2.08: Domain d3cswb1: 3csw B:1-273

Lineage for d3cswb1 (3csw B:1-273)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.0: automated matches [191499] (1 protein)
   not a true family

6. Protein automated matches [190815] (21 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry)

8. Domain d3cswb1: 3csw B:1-273 [173440]
   Other proteins in same PDB: d3cswa2, d3cswb2, d3cswc2, d3cswd2
   automated match to d1a3ga_
   complexed with cit, cl, mpd, plp, unl

Details for d3cswb1

PDB Entry: 3csw, 2.15 Å

PDB Description: crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution

PDB Compounds: (B:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3cswb1:

Sequence; same for both SEQRES and ATOM records:

>d3cswb1 e.17.1.0 (B:1-273) automated matches {Thermotoga maritima [TaxId: 243274]}
vliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffnl
plslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisnv
rripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegklit
psldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrlne
hsffeeepgpvtatlmenfepfvlnleenwvgi

Timeline for d3cswb1:

• d3cswb1 first appeared in SCOPe 2.01, called d3cswb_
  
• d3cswb1 appears in SCOPe 2.07