Lineage for d3cspa1 (3csp A:2-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354786Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)
  7. 2354787Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)
  8. 2354789Domain d3cspa1: 3csp A:2-121 [173438]
    Other proteins in same PDB: d3cspa2
    automated match to d1pkoa_
    mutant

Details for d3cspa1

PDB Entry: 3csp (more details), 1.7 Å

PDB Description: crystal structure of the dm2 mutant of myelin oligodendrocyte glycoprotein
PDB Compounds: (A:) Myelin-oligodendrocyte glycoprotein

SCOPe Domain Sequences for d3cspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cspa1 b.1.1.1 (A:2-121) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdaeq
apeyrgrtellkesigegkvalriqnvrfsdeggytcffrdaeyqeeaavelkvedpfyw

SCOPe Domain Coordinates for d3cspa1:

Click to download the PDB-style file with coordinates for d3cspa1.
(The format of our PDB-style files is described here.)

Timeline for d3cspa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cspa2