| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries) |
| Domain d3cspa1: 3csp A:2-121 [173438] Other proteins in same PDB: d3cspa2 automated match to d1pkoa_ mutant |
PDB Entry: 3csp (more details), 1.7 Å
SCOPe Domain Sequences for d3cspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cspa1 b.1.1.1 (A:2-121) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdaeq
apeyrgrtellkesigegkvalriqnvrfsdeggytcffrdaeyqeeaavelkvedpfyw
Timeline for d3cspa1: