Lineage for d3cslc1 (3csl C:2-173)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943155Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2943156Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2943157Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
    automatically mapped to Pfam PF06438
  6. 2943158Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 2943159Species Serratia marcescens [TaxId:615] [54624] (6 PDB entries)
  8. 2943163Domain d3cslc1: 3csl C:2-173 [173434]
    Other proteins in same PDB: d3cslc2, d3csld2
    automated match to d1b2va_
    complexed with gol, hem

Details for d3cslc1

PDB Entry: 3csl (more details), 2.7 Å

PDB Description: Structure of the Serratia marcescens hemophore receptor HasR in complex with its hemophore HasA and heme
PDB Compounds: (C:) hemophore hasa

SCOPe Domain Sequences for d3cslc1:

Sequence, based on SEQRES records: (download)

>d3cslc1 d.35.1.1 (C:2-173) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat

Sequence, based on observed residues (ATOM records): (download)

>d3cslc1 d.35.1.1 (C:2-173) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdansggfyggslsgsqyaisstanqvtafvagg
nltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnlsslqaqghdgv
vhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat

SCOPe Domain Coordinates for d3cslc1:

Click to download the PDB-style file with coordinates for d3cslc1.
(The format of our PDB-style files is described here.)

Timeline for d3cslc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cslc2