SCOPe 2.07: Domain d3cseb1: 3cse B:3-217

Lineage for d3cseb1 (3cse B:3-217)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Candida glabrata [TaxId:5478] [188672] (1 PDB entry)

8. Domain d3cseb1: 3cse B:3-217 [173433]
   Other proteins in same PDB: d3csea2, d3cseb2
   automated match to d1ai9a_
   complexed with n22, ndp

Details for d3cseb1

PDB Entry: 3cse, 1.6 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 2,4- diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3cseb1:

Sequence; same for both SEQRES and ATOM records:

>d3cseb1 c.71.1.1 (B:3-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

Timeline for d3cseb1:

• d3cseb1 first appeared in SCOPe 2.01, called d3cseb_
  
• d3cseb1 appears in SCOPe 2.06
  
• d3cseb1 appears in the current release, SCOPe 2.08