Lineage for d3csea_ (3cse A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871959Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1871969Species Candida glabrata [TaxId:5478] [188672] (1 PDB entry)
  8. 1871970Domain d3csea_: 3cse A: [173432]
    automated match to d1ai9a_
    complexed with n22, ndp

Details for d3csea_

PDB Entry: 3cse (more details), 1.6 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 2,4- diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3csea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3csea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

SCOPe Domain Coordinates for d3csea_:

Click to download the PDB-style file with coordinates for d3csea_.
(The format of our PDB-style files is described here.)

Timeline for d3csea_: