![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein beta-keto acyl carrier protein reductase [51788] (8 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries) Uniprot P16544 #SP |
![]() | Domain d3csda_: 3csd A: [173431] Other proteins in same PDB: d3csdb2 automated match to d1w4zb_ complexed with emo, ndp; mutant |
PDB Entry: 3csd (more details), 2.29 Å
SCOPe Domain Sequences for d3csda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3csda_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr svpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltgvfrvtkqv lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa avtaqalnvcgglgny
Timeline for d3csda_: