Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species) |
Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries) Uniprot P0A434 30-365 |
Domain d3cs2p_: 3cs2 P: [173426] automated match to d1i0bb_ complexed with cac, co; mutant |
PDB Entry: 3cs2 (more details), 1.95 Å
SCOPe Domain Sequences for d3cs2p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cs2p_ c.1.9.3 (P:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} gdrintvrgpitiseagftlthehicassagflrawpeffgsrkalaekavrglrraraa gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa aifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallg irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi pflrekgvpqetlagitvtnparflsptlr
Timeline for d3cs2p_: