SCOPe 2.07: Domain d3cs2p_: 3cs2 P:

Lineage for d3cs2p_ (3cs2 P:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)

7. Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries)
   Uniprot P0A434 30-365

8. Domain d3cs2p_: 3cs2 P: [173426]
   automated match to d1i0bb_
   complexed with cac, co; mutant

Details for d3cs2p_

PDB Entry: 3cs2, 1.95 Å

PDB Description: crystal structure of pte g60a mutant

PDB Compounds: (P:) Parathion hydrolase

SCOPe Domain Sequences for d3cs2p_:

Sequence; same for both SEQRES and ATOM records:

>d3cs2p_ c.1.9.3 (P:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicassagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallg
irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
pflrekgvpqetlagitvtnparflsptlr

Timeline for d3cs2p_:

• d3cs2p_ first appeared in SCOPe 2.01
  
• d3cs2p_ appears in SCOPe 2.06
  
• d3cs2p_ appears in the current release, SCOPe 2.08