SCOPe 2.05: Domain d3cr6a_: 3cr6 A:

Lineage for d3cr6a_ (3cr6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (34 PDB entries)

8. Domain d3cr6a_: 3cr6 A: [173422]
   automated match to d1bm5a_
   complexed with lsr; mutant

Details for d3cr6a_

PDB Entry: 3cr6, 1.22 Å

PDB Description: crystal structure of the r132k:r111l:a32e mutant of cellular retinoic acid binding protein type ii complexed with c15-aldehyde (a retinal analog) at 1.22 angstrom resolution.

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3cr6a_:

Sequence; same for both SEQRES and ATOM records:

>d3cr6a_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkievaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
ltmtaddvvctkvyvre

Timeline for d3cr6a_:

• d3cr6a_ first appeared in SCOPe 2.01
  
• d3cr6a_ appears in SCOPe 2.04
  
• d3cr6a_ appears in SCOPe 2.06
  
• d3cr6a_ appears in the current release, SCOPe 2.08