SCOPe 2.05: Domain d3cqlb_: 3cql B:

Lineage for d3cqlb_ (3cql B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (7 species)
   not a true protein

7. Species Papaya (Carica papaya) [TaxId:3649] [188512] (1 PDB entry)

8. Domain d3cqlb_: 3cql B: [173412]
   automated match to d1cnsa_
   complexed with gol, nag, ndg, so4

Details for d3cqlb_

PDB Entry: 3cql, 1.5 Å

PDB Description: crystal structure of gh family 19 chitinase from carica papaya

PDB Compounds: (B:) Endochitinase

SCOPe Domain Sequences for d3cqlb_:

Sequence; same for both SEQRES and ATOM records:

>d3cqlb_ d.2.1.1 (B:) automated matches {Papaya (Carica papaya) [TaxId: 3649]}
giekiisrsmfdqmlkhrnnpacpakgfytydafiaaaksfpsfgttgstdvrkreiaaf
lgqtshettggwpsapdgpyawgycflkernpssnycapsprypcapgksyygrgpiqls
wnynygpcgealrvnllgnpdlvatdrvisfktalwfwmtpqapkpschdvitgrwqpsa
adtaagrlpgygvitniingglecgkgpnpqvadrigffrrycgilgvgtgnnldcynqr
pfg

Timeline for d3cqlb_:

• d3cqlb_ first appeared in SCOPe 2.01
  
• d3cqlb_ appears in SCOPe 2.04
  
• d3cqlb_ appears in SCOPe 2.06
  
• d3cqlb_ appears in the current release, SCOPe 2.08