Lineage for d3cqla_ (3cql A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924182Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2924190Protein automated matches [190455] (7 species)
    not a true protein
  7. 2924205Species Papaya (Carica papaya) [TaxId:3649] [188512] (1 PDB entry)
  8. 2924206Domain d3cqla_: 3cql A: [173411]
    automated match to d1cnsa_
    complexed with gol, nag, ndg, so4

Details for d3cqla_

PDB Entry: 3cql (more details), 1.5 Å

PDB Description: crystal structure of gh family 19 chitinase from carica papaya
PDB Compounds: (A:) Endochitinase

SCOPe Domain Sequences for d3cqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqla_ d.2.1.1 (A:) automated matches {Papaya (Carica papaya) [TaxId: 3649]}
giekiisrsmfdqmlkhrnnpacpakgfytydafiaaaksfpsfgttgstdvrkreiaaf
lgqtshettggwpsapdgpyawgycflkernpssnycapsprypcapgksyygrgpiqls
wnynygpcgealrvnllgnpdlvatdrvisfktalwfwmtpqapkpschdvitgrwqpsa
adtaagrlpgygvitniingglecgkgpnpqvadrigffrrycgilgvgtgnnldcynqr
pfg

SCOPe Domain Coordinates for d3cqla_:

Click to download the PDB-style file with coordinates for d3cqla_.
(The format of our PDB-style files is described here.)

Timeline for d3cqla_: