Lineage for d3cqda_ (3cqd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137793Species Escherichia coli [TaxId:562] [188596] (4 PDB entries)
  8. 2137798Domain d3cqda_: 3cqd A: [173409]
    automated match to d2abqa1
    complexed with atp, mg

Details for d3cqda_

PDB Entry: 3cqd (more details), 1.98 Å

PDB Description: structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli
PDB Compounds: (A:) 6-phosphofructokinase isozyme 2

SCOPe Domain Sequences for d3cqda_:

Sequence, based on SEQRES records: (download)

>d3cqda_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
qkiyaylsr

Sequence, based on observed residues (ATOM records): (download)

>d3cqda_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatllcshddtqkiya
ylsr

SCOPe Domain Coordinates for d3cqda_:

Click to download the PDB-style file with coordinates for d3cqda_.
(The format of our PDB-style files is described here.)

Timeline for d3cqda_: