SCOPe 2.01: Domain d3cqab_: 3cqa B:

Lineage for d3cqab_ (3cqa B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (31 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d3cqab_: 3cqa B: [173408]
   automated match to d1jqza_
   complexed with fmt, so4; mutant

Details for d3cqab_

PDB Entry: 3cqa, 1.8 Å

PDB Description: crystal structure of human fibroblast growth factor-1 with mutations glu81ala and lys101ala

PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3cqab_:

Sequence; same for both SEQRES and ATOM records:

>d3cqab_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpnaeclflerleenhyntyiskahaeknwfvglkkngs
ckrgprthygqkailflplpv

Timeline for d3cqab_:

• d3cqab_ is new in SCOPe 2.01-stable
  
• d3cqab_ appears in SCOPe 2.02
  
• d3cqab_ appears in the current release, SCOPe 2.08