Lineage for d3cq3e_ (3cq3 E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904817Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 1904828Family d.52.8.2: PaaD-like [117922] (3 proteins)
    Pfam PF01883; DUF59
  6. 1904836Protein automated matches [190571] (1 species)
    not a true protein
  7. 1904837Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries)
  8. 1904848Domain d3cq3e_: 3cq3 E: [173406]
    automated match to d2cu6a1
    complexed with gol, mg, p6g, pg4

Details for d3cq3e_

PDB Entry: 3cq3 (more details), 2.1 Å

PDB Description: Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8
PDB Compounds: (E:) Putative uncharacterized protein TTHB138

SCOPe Domain Sequences for d3cq3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cq3e_ d.52.8.2 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav
rqalsrlpgveevevevtfeppwtlarlsekarrllgw

SCOPe Domain Coordinates for d3cq3e_:

Click to download the PDB-style file with coordinates for d3cq3e_.
(The format of our PDB-style files is described here.)

Timeline for d3cq3e_: