Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.2: PaaD-like [117922] (3 proteins) Pfam PF01883; DUF59 |
Protein automated matches [190571] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries) |
Domain d3cq3e_: 3cq3 E: [173406] automated match to d2cu6a1 complexed with gol, mg, p6g, pg4 |
PDB Entry: 3cq3 (more details), 2.1 Å
SCOPe Domain Sequences for d3cq3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cq3e_ d.52.8.2 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav rqalsrlpgveevevevtfeppwtlarlsekarrllgw
Timeline for d3cq3e_:
View in 3D Domains from other chains: (mouse over for more information) d3cq3a_, d3cq3b_, d3cq3c_, d3cq3d_ |