Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.2: PaaD-like [117922] (3 proteins) Pfam PF01883; DUF59 |
Protein automated matches [190571] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries) |
Domain d3cq2a_: 3cq2 A: [173398] automated match to d2cu6a1 |
PDB Entry: 3cq2 (more details), 1.9 Å
SCOPe Domain Sequences for d3cq2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cq2a_ d.52.8.2 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} leaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavrq alsrlpgveevevevtfeppwtlarlsekarrllgw
Timeline for d3cq2a_: