SCOPe 2.06: Domain d3cq2a_: 3cq2 A:

Lineage for d3cq2a_ (3cq2 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.2: PaaD-like [117922] (3 proteins)
   Pfam PF01883; DUF59

6. Protein automated matches [190571] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries)

8. Domain d3cq2a_: 3cq2 A: [173398]
   automated match to d2cu6a1

Details for d3cq2a_

PDB Entry: 3cq2, 1.9 Å

PDB Description: Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8

PDB Compounds: (A:) Putative uncharacterized protein TTHB138

SCOPe Domain Sequences for d3cq2a_:

Sequence; same for both SEQRES and ATOM records:

>d3cq2a_ d.52.8.2 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
leaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavrq
alsrlpgveevevevtfeppwtlarlsekarrllgw

Timeline for d3cq2a_:

• d3cq2a_ first appeared in SCOPe 2.01
  
• d3cq2a_ appears in SCOPe 2.05
  
• d3cq2a_ appears in SCOPe 2.07
  
• d3cq2a_ appears in the current release, SCOPe 2.08