Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (20 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188824] (1 PDB entry) |
Domain d3cq0b_: 3cq0 B: [173396] automated match to d1f05a_ complexed with edo, gol, pg4 |
PDB Entry: 3cq0 (more details), 1.9 Å
SCOPe Domain Sequences for d3cq0b_:
Sequence, based on SEQRES records: (download)
>d3cq0b_ c.1.10.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atssleqlkkagthvvadsgdfeaiskyepqdsttnpslilaasklekyarfidaaveyg rkhgktdhekienamdkilvefgtqilkvvpgrvstevdarlsfdkkatvkkalhiikly kdagvpkervlikiastwegiqaarelevkhgihcnmtllfsftqavacaeanvtlispf vgrimdfykalsgkdytaetdpgvlsvkkiysyykrhgyatevmaasfrnldelkalagi dnmtlplnlleqlyestdpienklnsesakeegvekvsfindephfryvlnedqmatekl sdgirkfsadiealyklveekmlehhhh
>d3cq0b_ c.1.10.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atssleqlkkagthvvadsgdfeaiskyepqdsttnpslilaasklekyarfidaaveyg rkhgktdhekienamdkilvefgtqilkvvpgrvstevdarlsfdkkatvkkalhiikly kdagvpkervlikiastwegiqaarelevkhgihcnmtllfsftqavacaeanvtlispf vgrimdfykaytaetdpgvlsvkkiysyykrhgyatevmaasfrnldelkalagidnmtl plnlleqlyestdpienklnsesakeegvekvsfindephfryvlnedqmateklsdgir kfsadiealyklveekmlehhhh
Timeline for d3cq0b_: