![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein automated matches [190095] (28 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188824] (1 PDB entry) |
![]() | Domain d3cq0a1: 3cq0 A:12-333 [173395] Other proteins in same PDB: d3cq0a2, d3cq0b2 automated match to d1f05a_ complexed with edo, gol, pg4 |
PDB Entry: 3cq0 (more details), 1.9 Å
SCOPe Domain Sequences for d3cq0a1:
Sequence, based on SEQRES records: (download)
>d3cq0a1 c.1.10.1 (A:12-333) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atssleqlkkagthvvadsgdfeaiskyepqdsttnpslilaasklekyarfidaaveyg rkhgktdhekienamdkilvefgtqilkvvpgrvstevdarlsfdkkatvkkalhiikly kdagvpkervlikiastwegiqaarelevkhgihcnmtllfsftqavacaeanvtlispf vgrimdfykalsgkdytaetdpgvlsvkkiysyykrhgyatevmaasfrnldelkalagi dnmtlplnlleqlyestdpienklnsesakeegvekvsfindephfryvlnedqmatekl sdgirkfsadiealyklveekm
>d3cq0a1 c.1.10.1 (A:12-333) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atssleqlkkagthvvadsgdfeaiskyepqdsttnpslilaasklekyarfidaaveyg rkhgktdhekienamdkilvefgtqilkvvpgrvstevdarlsfdkkatvkkalhiikly kdagvpkervlikiastwegiqaarelevkhgihcnmtllfsftqavacaeanvtlispf vgrimdfykaldytaetdpgvlsvkkiysyykrhgyatevmaasfrnldelkalagidnm tlplnlleqlyestdpienklnsesakeegvekvsfindephfryvlnedqmateklsdg irkfsadiealyklveekm
Timeline for d3cq0a1: