Lineage for d1eh2__ (1eh2 -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47792Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (3 proteins)
  6. 47793Protein Eps15 [47544] (2 species)
  7. 47794Species Human (Homo sapiens) [TaxId:9606] [47546] (4 PDB entries)
  8. 47798Domain d1eh2__: 1eh2 - [17339]

Details for d1eh2__

PDB Entry: 1eh2 (more details)

PDB Description: structure of the second eps15 homology domain of human eps15, nmr, 20 structures

SCOP Domain Sequences for d1eh2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh2__ a.39.1.6 (-) Eps15 {Human (Homo sapiens)}
pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
drdefavamflvycalekepvpmslppalvppskr

SCOP Domain Coordinates for d1eh2__:

Click to download the PDB-style file with coordinates for d1eh2__.
(The format of our PDB-style files is described here.)

Timeline for d1eh2__: