![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species) PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56161] (20 PDB entries) |
![]() | Domain d3cp9a_: 3cp9 A: [173385] automated match to d1vr2a_ complexed with c19 |
PDB Entry: 3cp9 (more details), 2.5 Å
SCOPe Domain Sequences for d3cp9a_:
Sequence, based on SEQRES records: (download)
>d3cp9a_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} aerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegath sehralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefv pykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicd fglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspy pgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqa naqqdrhhhhhh
>d3cp9a_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} aerlpydaskwefprdrlklgkplqvieadafgidktatcrtvavkmlkegathsehral mselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpykvap edlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglplk wmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdy ttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqdrhhhhhh
Timeline for d3cp9a_: