Lineage for d3copa_ (3cop A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2159528Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2159529Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2160034Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2160035Protein automated matches [190965] (26 species)
    not a true protein
  7. 2160085Species Escherichia coli [TaxId:562] [188591] (6 PDB entries)
  8. 2160087Domain d3copa_: 3cop A: [173384]
    automated match to d1rzub_
    complexed with 250, adp, glc; mutant

Details for d3copa_

PDB Entry: 3cop (more details), 2.3 Å

PDB Description: crystal structure of e.coli gs mutant e377a in complex with adp and acceptor analogue heppso
PDB Compounds: (A:) Glycogen synthase

SCOPe Domain Sequences for d3copa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3copa_ c.87.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mqvlhvcsemfpllktggladvigalpaaqiadgvdarvllpafpdirrgvtdaqvvsrr
dtfaghitllfghyngvgiylidaphlydrpgspyhdtnlfaytdnvlrfallgwvgaem
asgldpfwrpdvvhahdwhaglapaylaargrpaksvftvhnlayqgmfyahhmndiqlp
wsffnihglefngqisflkaglyyadhitavsptyareitepqfaygmegllqqrhregr
lsgvlngvdekiwspetdlllasrytrdtledkaenkrqlqiamglkvddkvplfavvsr
ltsqkgldlvlealpglleqggqlallgagdpvlqegflaaaaeypgqvgvqigyheafs
hrimggadvilvpsrfapcgltqlyglkygtlplvrrtggladtvsdcslenladgvasg
fvfedsnawsllrairrafvlwsrpslwrfvqrqamamdfswqvaaksyrelyyrl

SCOPe Domain Coordinates for d3copa_:

Click to download the PDB-style file with coordinates for d3copa_.
(The format of our PDB-style files is described here.)

Timeline for d3copa_: