Lineage for d1c07a_ (1c07 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3442Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (1 protein)
  6. 3443Protein Eps15 [47544] (2 species)
  7. 3444Species Human (Homo sapiens) [TaxId:9606] [47546] (4 PDB entries)
  8. 3445Domain d1c07a_: 1c07 A: [17337]

Details for d1c07a_

PDB Entry: 1c07 (more details)

PDB Description: structure of the third eps15 homology domain of human eps15

SCOP Domain Sequences for d1c07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens)}
twvvspaekakydeiflktdkdmdgfvsglevreiflktglpstllahiwslcdtkdcgk
lskdqfalafhlisqklikgidpphvltpemipps

SCOP Domain Coordinates for d1c07a_:

Click to download the PDB-style file with coordinates for d1c07a_.
(The format of our PDB-style files is described here.)

Timeline for d1c07a_: