| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
| Protein automated matches [190243] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries) |
| Domain d3co6c_: 3co6 C: [173367] automated match to d1e17a_ protein/DNA complex; complexed with ca, cl |
PDB Entry: 3co6 (more details), 2.1 Å
SCOPe Domain Sequences for d3co6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3co6c_ a.4.5.14 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssrrnawgnlsyadlitkaiessaekrltlsqiyewmvksvpyfkdkgdsnssagwknsi
rhnlslhskfirvqnegtgksswwmlnpegg
Timeline for d3co6c_: