Lineage for d3co2d_ (3co2 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1808270Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1808276Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1808417Protein automated matches [190352] (8 species)
    not a true protein
  7. 1808458Species Mesorhizobium loti [TaxId:381] [188511] (2 PDB entries)
  8. 1808462Domain d3co2d_: 3co2 D: [173366]
    automated match to d1vp6a_
    mutant

Details for d3co2d_

PDB Entry: 3co2 (more details), 2.9 Å

PDB Description: mlotik1 ion channel cyclic-nucleotide binding domain mutant
PDB Compounds: (D:) Mlotik1 ion channel protein

SCOPe Domain Sequences for d3co2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3co2d_ b.82.3.2 (D:) automated matches {Mesorhizobium loti [TaxId: 381]}
rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
svsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspeia
eifrktale

SCOPe Domain Coordinates for d3co2d_:

Click to download the PDB-style file with coordinates for d3co2d_.
(The format of our PDB-style files is described here.)

Timeline for d3co2d_: