Lineage for d3co1a1 (3co1 A:1-130)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325183Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2325247Protein automated matches [191021] (2 species)
    not a true protein
  7. 2325248Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)
  8. 2325249Domain d3co1a1: 3co1 A:1-130 [173362]
    Other proteins in same PDB: d3co1a2
    automated match to d1pa7a_

Details for d3co1a1

PDB Entry: 3co1 (more details), 1.4 Å

PDB Description: Crystal structure of microtubule binding domain of human EB3
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 3

SCOPe Domain Sequences for d3co1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3co1a1 a.40.1.1 (A:1-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mavnvystsvtsenlsrhdmlawvndslhlnytkieqlcsgaaycqfmdmlfpgcvhlrk
vkfqakleheyihnfkvlqaafkkmgvdkiipveklvkgkfqdnfefiqwfkkffdanyd
gkdynpllar

SCOPe Domain Coordinates for d3co1a1:

Click to download the PDB-style file with coordinates for d3co1a1.
(The format of our PDB-style files is described here.)

Timeline for d3co1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3co1a2