Lineage for d3co0p_ (3co0 P:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026884Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) (S)
  5. 1026905Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
    decorated with additional structure
  6. 1026918Protein automated matches [190926] (1 species)
    not a true protein
  7. 1026919Species Bacillus amyloliquefaciens [TaxId:1390] [188457] (3 PDB entries)
  8. 1026922Domain d3co0p_: 3co0 P: [173360]
    Other proteins in same PDB: d3co0s_
    automated match to d1spbp_
    complexed with zn

Details for d3co0p_

PDB Entry: 3co0 (more details), 1.93 Å

PDB Description: substrate complex of fluoride-sensitive engineered subtilisin subt_bacam
PDB Compounds: (P:) subtilisin bpn'

SCOPe Domain Sequences for d3co0p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3co0p_ d.58.3.2 (P:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv
eedklyralsa

SCOPe Domain Coordinates for d3co0p_:

Click to download the PDB-style file with coordinates for d3co0p_.
(The format of our PDB-style files is described here.)

Timeline for d3co0p_: