![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) ![]() |
![]() | Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins) decorated with additional structure |
![]() | Protein automated matches [190926] (1 species) not a true protein |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [188457] (3 PDB entries) |
![]() | Domain d3co0p_: 3co0 P: [173360] Other proteins in same PDB: d3co0s_ automated match to d1spbp_ complexed with zn |
PDB Entry: 3co0 (more details), 1.93 Å
SCOPe Domain Sequences for d3co0p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3co0p_ d.58.3.2 (P:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv eedklyralsa
Timeline for d3co0p_: