SCOPe 2.06: Domain d1f8ha_: 1f8h A:

Lineage for d1f8ha_ (1f8h A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (3 proteins)

6. Protein Eps15 [47544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47546] (5 PDB entries)

8. Domain d1f8ha_: 1f8h A: [17336]
   second EH domain
   complexed with ca

Details for d1f8ha_

PDB Entry: 1f8h

PDB Description: structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfr

PDB Compounds: (A:) epidermal growth factor receptor substrate 15

SCOPe Domain Sequences for d1f8ha_:

Sequence; same for both SEQRES and ATOM records:

>d1f8ha_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}
pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
drdefavamflvycalekepvpmslppalvppskr

Timeline for d1f8ha_:

• d1f8ha_ first appeared (with stable ids) in SCOP 1.55
  
• d1f8ha_ appears in SCOPe 2.05
  
• d1f8ha_ appears in SCOPe 2.07
  
• d1f8ha_ appears in the current release, SCOPe 2.08