Lineage for d3cnkb_ (3cnk B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938049Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 938095Protein automated matches [190375] (1 species)
    not a true protein
  7. 938096Species Human (Homo sapiens) [TaxId:9606] [187222] (3 PDB entries)
  8. 938098Domain d3cnkb_: 3cnk B: [173354]
    automated match to d1v05a_
    complexed with so4

Details for d3cnkb_

PDB Entry: 3cnk (more details), 1.65 Å

PDB Description: crystal structure of the dimerization domain of human filamin a
PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d3cnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cnkb_ b.1.18.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvakglglskayvgqkssftvdcskagnnmllvgvhgprtpceeilvkhvgsrlysvsy
llkdkgeytlvvkwghehipgspyrvvvp

SCOPe Domain Coordinates for d3cnkb_:

Click to download the PDB-style file with coordinates for d3cnkb_.
(The format of our PDB-style files is described here.)

Timeline for d3cnkb_: