| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
| Protein Filamin a [141023] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141024] (8 PDB entries) Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328 |
| Domain d3cnka_: 3cnk A: [173353] automated match to d1v05a_ complexed with so4 |
PDB Entry: 3cnk (more details), 1.65 Å
SCOPe Domain Sequences for d3cnka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cnka_ b.1.18.10 (A:) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
kvvakglglskayvgqkssftvdcskagnnmllvgvhgprtpceeilvkhvgsrlysvsy
llkdkgeytlvvkwghehipgspyrvvvp
Timeline for d3cnka_: