SCOPe 2.06: Domain d3cn7d_: 3cn7 D:

Lineage for d3cn7d_ (3cn7 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)

6. Protein automated matches [191018] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188798] (2 PDB entries)

8. Domain d3cn7d_: 3cn7 D: [173350]
   automated match to d1auoa_
   complexed with mes

Details for d3cn7d_

PDB Entry: 3cn7, 2.99 Å

PDB Description: crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form

PDB Compounds: (D:) carboxylesterase

SCOPe Domain Sequences for d3cn7d_:

Sequence; same for both SEQRES and ATOM records:

>d3cn7d_ c.69.1.14 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
seplildapnadaciiwlhglgadrtdfkpvaealqmvlpstrfilpqapsqavtvnggw
vmpswydilafsparaidedqlnasadqvialideqrakgiaaeriilagfsqggavvlh
tafrryaqplggvlalstyaptfddlalderhkripvlhlhgsqddvvdpalgraahdal
qaqgvevgwhdypmghevsleeihdigawlrkrl

Timeline for d3cn7d_:

• d3cn7d_ first appeared in SCOPe 2.01
  
• d3cn7d_ appears in SCOPe 2.05
  
• d3cn7d_ appears in SCOPe 2.07
  
• d3cn7d_ appears in the current release, SCOPe 2.08